PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_A6733B734.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 464aa    MW: 49971.3 Da    PI: 8.3965
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_A6733B734.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32183242160
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                            ++DgynWrKYGqK+vkgse+prsYY+Ct+++C++kkkvers  d+++++i+Y+g H+h+k
  Traes_1DS_A6733B734.1 183 VEDGYNWRKYGQKQVKGSENPRSYYKCTYNNCSMKKKVERSLADGRITQIVYKGAHDHPK 242
                            58********************************************************85 PP

2WRKY103.31.3e-32337395159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDg++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d+++v++tYeg+H h+
  Traes_1DS_A6733B734.1 337 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDNRAVITTYEGKHSHD 395
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.016178243IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.0E-28179243IPR003657WRKY domain
SuperFamilySSF1182901.83E-25182243IPR003657WRKY domain
SMARTSM007741.4E-34183242IPR003657WRKY domain
PfamPF031061.4E-24184241IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.5E-36322397IPR003657WRKY domain
SuperFamilySSF1182907.19E-29329397IPR003657WRKY domain
PROSITE profilePS5081137.436332397IPR003657WRKY domain
SMARTSM007747.0E-38337396IPR003657WRKY domain
PfamPF031062.5E-25338395IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MSSSTGSLDH AGFTFTPPPF ITSFTELLSG SGAGDAERSP RGFNRGGRAG APKFKSAQPP  60
SLPISSPFSC FSIPAGLSPA ELLDSPVLLN YSHILASPTT GAIPARRYDW QASADLNTFQ  120
QDEPCRGDSG LFGFSFHAVK SNATVNAQAN CLPLFKEQQQ QQQQQVVEVS NKSSSGGGNN  180
KQVEDGYNWR KYGQKQVKGS ENPRSYYKCT YNNCSMKKKV ERSLADGRIT QIVYKGAHDH  240
PKPLSTRRNS SGCAAVVAED HANGSEHSGP TPENSSVTFG DDEADNGLQL SDGAEPVTKR  300
RKEHADNEGS SGGTGGCGKP VREPRLVVQT LSDIDILDDG FRWRKYGQKV VKGNPNPRSY  360
YKCTTVGCPV RKHVERASHD NRAVITTYEG KHSHDVPVGR GRALPATSSS DSSGVIWPAA  420
VPAPYTLEML TNPAAGHRGY AAGGAFQRTK DEPRDDMFVE SLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-34183397877Probable WRKY transcription factor 4
2lex_A3e-34183397877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654250.0EU665425.1 Triticum aestivum WRKY2 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147551.10.0WRKY53 - superfamily of TFs having WRKY and zinc finger domains
SwissprotQ8S8P52e-99WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLW5AMI20.0W5AMI2_WHEAT; Uncharacterized protein
TrEMBLM8C7180.0M8C718_AEGTA; Putative WRKY transcription factor 33
STRINGSi021956m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85333448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-91WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]